SKU: 17110938049

Human ATF4 , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ATF4 , His tagProduct Specification Species Human Synonyms Activating transcription factor 4, Cyclic AMP responsive element binding protein 2, CREB 2, cAMP responsive element binding protein 2, Tax responsive enhancer element binding protein 67, TaxREB67, TXREB Accession P18848 Amino Acid Sequence Protein sequence(P18848, Phe20 Tyr200, with C 10*His)

Product Specification


Species Human
Synonyms Activating transcription factor 4, Cyclic AMP-responsive element-binding protein 2, CREB-2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, TaxREB67, TXREB
Accession P18848
Amino Acid Sequence

Protein sequence(P18848, Phe20-Tyr200, with C-10*His) FDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:21.4kDa Actual:29kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Activating transcription factor 4 (tax-responsive enhancer element B67), also known as ATF4, is a protein that in humans is encoded by the ATF4 gene. This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). ATF4 is not a functional transcription factor by itself but one-half of many possible heterodimeric transcription factors. ATF4 belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. ATF4 transcription factor is also known to play role in osteoblast differentiation along with RUNX2 and osterix.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17110938049

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 768 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Denisse Hdez
Phoenix, US
★★★★★ 5
Is does the job, love it.
Size: 60% Compact
Is really comfy, it does the job, you can't go wrong with it. Just buy it if you have a 75% keyboard or less because is not long. For me is not a problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
T
Verified Purchase
Timothy Porter
Phoenix, US
★★★★★ 5
Nice wrist rest
Size: 100% Standard
Comfortable angle, solid enough to not move around but soft enough to be good for long term usage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
E
Verified Purchase
Erik Olson
San Leandro, US
★★★★★ 5
Excellent wrist rest, BUT not for me
I'm rating this wrist rest 5 stars despite the fact that it's not for me. The reason that it is not for me is simple: My palms get very sweaty, and this makes my palms stick to the wrist rest, making it hard to move my hands around. This is an inherent limitation of the fact that it is made out of wood, and drove me to the 17" x 4" x 0.75" foam wrist rest from Grifiti instead. If you don't have sweaty palms, however, this wrist rest is perfect. It is 4 inches deep instead of the typical 3.1 inches, it is the perfect height and tapered just so for maximum comfort, the wood (Golden Oak color) is beautiful, and the engraved logo is tasteful and non-intrusive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2023
M
Verified Purchase
MM
Boise, US
★★★★★ 5
The perfect wrist rest. Stop looking, just buy this one!
Color: Onyx, Size: Tenkeyless/TKL Keyboard Wrist Rest, Color: Onyx, Size: Tenkeyless/TKL Keyboard Wrist Rest
The perfect wrist rest. I used those gel and silicone wrist rests thinking the softer they are the better. Not so. This is solid hardwood and my wrists no longer ache after a long day at the computer. The size I picked is perfect for a TKL keyboard. The angles, height, and design are optimal for a comfortable typing experience. Even 8-10 hours of typing! I love Glorious' products, they come so well packaged and attention to every detail is given. Gosh, its just a wrist rest! No, it is a tool that provides comfortable work experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2025
X
Verified Purchase
Xie Xie
Grantham, US
★★★★★ 5
The wood is great.
I used to use a typical padded wrist pad, but am a heavy sweater. Upon reading another review in regards to that matter I decided to take the plunge on this rest. I have been a user of the Model O mouse from Glorious for a while and liked it so I trusted the company's reputation for taking gamers' needs into consideration. After using it for about a week and playing different types of games/working from home on it, I can say that although your sweat might pool during sweaty moments, it's easy to wipe off and doesn't seem to easily absorb into the wood. The wood itself is of a nice quality, I like the oak over the onyx for a more "real wood" look. There was no difference in comfort for me, you'd think being used to a padded wrist this shift would be "hard" on me, but no, I haven't had any problems. It's ergonomics for typing are also good as I notice my WPM and consistency be higher on multiple tests. All-in-all quite satisfied with the purchase, fits the aesthetic, feel, and ergonomics I was looking for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2021

recommand products