SKU: 43358953760

Human Calprotectin(S100A8), His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Calprotectin(S100A8), His tagProduct Specification Species Human Synonyms Calgranulin A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor related protein 8 (MRP 8; p8); Urinary stone protein band A; CAGA Accession P05109 Amino Acid Sequence Protein sequence(P05109, Met1 Glu93, with C 10*His) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA
Accession P05109
Amino Acid Sequence

Protein sequence(P05109, Met1-Glu93, with C-10*His)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.5 kDa Observed MW: 13.0 kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis and post COVID-19 condition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43358953760

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1981 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 3
Don’t buy
All it did was moisturize and it’s super thing and just liquid. I highly doubt this is actually protecting my skin from the sun. Leaves no cast at all though
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
K
Verified Purchase
Kgg
Charlottesville, US
★★★★★ 5
Lightweight No-Cast Collagen Sunscreen SPF 50+ PA++++ – Daily UVA & UVB Protection
This sunscreen offers reliable broad-spectrum protection with SPF 50+ and PA++++, helping shield the skin from harmful UVA and UVB rays. Its lightweight, moisturizing formula absorbs quickly without leaving a white cast, making it suitable for all skin tones. Infused with collagen, it helps keep the skin feeling soft and hydrated throughout the day. The non-greasy finish works well for daily use, leaving the skin with a natural, smooth appearance. A practical choice for anyone looking to combine sun protection with lightweight hydration in one step.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
L
Verified Purchase
Logan Calhoun
Lake Worth, US
★★★★★ 5
A solid story that flowed well.
Format: Kindle
Overall an enjoyable tale besides one character I liked being in the story and then shortly after being out of the story. But it was a fun read with great characters but so many that weren't given enough time to shine at all or be seen more. Looking forward to the next in the series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
D
DanaeReads
Bozeman, US
★★★★★ 4
This spin-off debut is a satisfying fix my fellow cozy flapper-era amateur-sleuth addicts!
Format: Kindle
4.25 I have no excuse. I’ve never read or listened to “The Scottish Ladies' Detective Agency” even though somebody physically gave me the book. In my defense, my kindle app and audiobooks are more friendly for ADHD and pain management and I haven’t read a physical book in years. I was starting fresh with Lady Poppy and this first book launches a spinoff series. Who doesn’t love a historic mystery, especially set in Scotland? This has many of the hallmarks of a series in the genre and I never know whether to complain about the repetition—or even near clones—or celebrate the opportunity to feed my addiction. In some respects, I found this refreshing because Poppy is wealthy. It seems like every other female sleuth in the 1920s and 30s has an aristocratic (or aristocratic adjacent) background but is now dirt poor. There are enough stresses about money these days that I prefer to focus on the murder. This is a tangled web of a story and I thought it clever and I liked Poppy if for no other reason than she has a fantastic lab and appreciates him (and other dogs). Of course, Major Charlie (extra points for the awesome name) saves the day a time or two. Oh and Poppy having a law degree, even when women couldn’t practice law, was a great asset and very cool. That said, if she wasn’t a Lady and very attractive, she would not have gotten away with her brazen interference (even in comparison to other amateur sleuths). In terms of the audiobook version, the narrator was good in most respects. The voice of the handsome inspector (among other male characters) was so deep and low that it drove me a little crazy. Lady Constance also sounded masculine and I had to stop and think every time I heard that voice which was contrary to the character. Overall, she did a good job on the various Scottish accents, including Poppy’s sophisticated mix of the King ‘s English and a Scottish lilt. Otherwise, this mystery was clever and I’m sad that I have to wait for the next one. I would wait for several so that I could finally binge them, but I’m not that strong. P.S. Apparently, neither Lydia Travers nor “The Scottish Ladies' Detective Agency” are even recognized by Libby (which recognizes practically every author) and the books are only available through Kindle Unlimited or buying them or the audiobooks, thus the reason I have not read them. Maybe one day! I am reviewing advanced copies of this book and audiobook given to me by the publisher. All views are strictly my own. . #DeathattheHighlandLoch #NetGalley #bookreview #ADHDreader #lydiatravers #Scottishladydetective #Scotland #historicmystery
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2025
D
Verified Purchase
D. Fiscus
Lake Worth, US
★★★★★ 5
Excellent!!!
Format: Kindle
I'm so excited to begin a new series by Lydia Travers! I have missed our Maud McIntyre, but Lady Poppy is a delightful! Ms Travers weaves an intriguing tale with interesting characters and the hope of a sweet, budding romance. Do yourself a favor and get it. You Will enjoy reading it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2025

recommand products