SKU: 50602339356

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms Gal 3, 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding protein, L 31, Laminin binding protein, Lectin L 29, Mac 2 antigen, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Met1 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:27.8kDa Actual:35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50602339356

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1187 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jack
Chelsea, US
★★★★★ 5
Mark T T-shirt
Size: XX-Large, Color: White
I’m content nice quality good price works for me
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
V
Verified Purchase
vivian
Lowell, US
★★★★★ 5
I like the shirt and the price was decent
Size: X-Large, Color: Black
Nice but I don’t like it on my neck. I’m giving it away as a gift.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2025
V
Verified Purchase
Victor
West Palm Beach, US
★★★★★ 1
Too small for the shown size.
Size: XX-Large, Color: Black, Size: XX-Large, Color: Black
I usually would buy XL size but in this case I bought XXL thinking since it's cotton it might shrink. But when I tried the T-shirt it was too small. My older XL sized T-shirt has 2 1/2" larger total shoulder width and 3" wider body width. See attached pictures. Length was also a bit shorter by about 1/2". I will to return it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
P
Verified Purchase
Pattie B
Battle Creek, US
★★★★★ 2
Does not match the size
Size: 3X-Large, Color: Blue
Way smaller than the size indicated. Very thin material, almost see- thru.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2025
R
Verified Purchase
Robert
Alexandria, US
★★★★★ 5
Will buy again
Size: XX-Large, Color: White
Very comfortable. Fits as expected,
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 15, 2025

recommand products