SKU: 10586894026

Human PIIINP, His Tag

Sale price$119.25 Regular price$132.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PIIINP, His TagProduct Specification Species Human Synonyms Collagen alpha 1(III) chainCOL3A1 Accession P02461 Amino Acid Sequence Protein sequence (P02461, Gln24 Pro153, with C 10*His) QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 23 30kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Collagen alpha-1(III) chain、COL3A1
Accession P02461
Amino Acid Sequence

Protein sequence (P02461, Gln24-Pro153, with C-10*His) QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 23-30kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

PIIINP is the amino terminal peptide of type III procollagen, released from the precursor peptide during the synthesis and deposition of type III collagen. PIIINP in the serum can be derived from the synthesis of new type III collagen or from the degradation of existing type III collagen fibrils. There is evidence that serum PIIINP measurement is an effective non-invasive test for the detection and monitoring of Methotrexate-induced liver fibrosis and cirrhosis, and serial measurements may reduce the need for liver biopsy. Dermatology patients with repeated normal levels of PIIINP are very unlikely to have significant liver damage from fibrosis or cirrhosis. Conversely a high serum PIIINP or series of high values may indicate that a liver biopsy is required and in some cases, that Methotresate should be withdrawn.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10586894026

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 782 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Just My 2 Cents
San Leandro, US
★★★★★ 5
Love denim and tired of cropped jackets?
Fit Type: Oversized, Size: Large, Color: Medium Blue Vintage
I like this a lot, it was what I was looking for as far as I'm so over everything you buy these days is cropped. Cropped styles are great, but are kind of getting old for some things in my opinion. The jacket is big as far as how it fits. I am 5'8" about 180 and I wish I would have got a medium, I got a large. The large is big and roomy enough that I could even wear ear a thick hoodie under it if I wanted to. However, the length is good as what I was looking for. The upper arms are large. However, this is a great quality denim jacket. Nice and thick, sturdy material (which I wanted). It's also at a great, competitive low price even if it's not on sale. Don't believe me, go ahead and search jean jackets. You'll see a ton, but I looked too and the quality did not look as good as this and plus the other jackets were a lot more for a lot less. If you're looking for a longer jean jacket, I highly recommend this. I'd say just think seriously about sizing down 1... even maybe 2 sizes. I would have gotten an XL before I read the other reviews. They recommended to size down, and after getting my jacket I could have sized down to a medium. I'm still happy with it and this is a jacket that is stitched well and will last a very long time. As always though, that's just my 2 cents. :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
B
Verified Purchase
Briana C.
Charlottesville, US
★★★★★ 4
Nice quality, shape not for me
Fit Type: Oversized, Size: Medium, Color: Medium Blue Vintage
This was just too boxy for my body. Material was nice, quality jean material. Color was true to image. It was a little stiff but as you would expect with nice, new and unwashed denim.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
M
Verified Purchase
M1so
Battle Creek, US
★★★★★ 5
Solid basic good denim jacket
Fit Type: Regular, Size: X-Large, Color: Authentic Medium Wash
In direct comparison to Levi’s women’s trucker denim jacket, this one is: slightly heavier denim, less stretchy, less fitted. I kept this one and returned the Levi’s because I wanted the roomier fit. I wish it was a little longer in the body: I’m tall, and it isn’t too short but I’d like a little more length. It feels slightly longer than the Levi’s. I wish the sleeves were longer too. They are probably just right for an average height or shorter person. The armholes could be smaller. The medium wash is a nice medium blue, fairly even in tone. It doesn’t have a lot of stretch but it’s comfortable. The denim is substantial but not too stiff. Overall, it’s a standard good quality denim jacket without any peculiar style elements or weird cut. It’s good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
M
Verified Purchase
Maryland Marcy
Grantham, US
★★★★★ 3
Fabric way to heavy.
Fit Type: Regular, Size: Medium, Color: White
Cute, but material is WAY to heavy, like the heaviest duty denim I've ever seen. Wanted this to be a cute coverup. If you're needing something while breaking broncos or riding your motorcycle would probably be great. I kept it for a while because it was good quality and well made, but it ended up in the donation pile as I'd never wear this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
C
Verified Purchase
Clare Lukes
Belleville, US
★★★★★ 5
Awesome jacket
Fit Type: Regular, Size: Medium, Color: Stone Dark Wash
Love it so not too long or too short but just right and the color is out of sight and fits awesome
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 12, 2026

recommand products