SKU: 57275905679

Human Collagen IV, His Tag

Sale price$99.00 Regular price$110.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Collagen IV, His TagProduct Specification Species Human Accession P02462 Amino Acid Sequence Protein sequence(P02462, Lys28 Lys172, with C 10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 28kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution

Product Specification


Species Human
Accession P02462
Amino Acid Sequence Protein sequence(P02462, Lys28-Lys172, with C-10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 28kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Collagen typte IV is a type of collagen found primarily in the basal lamina. Mutations to the genes coding for collagen IV lead to Alport syndrome. This will cause thinning and splitting of the glomerular basement membrane. It will present as isolated hematuria, sensorineural hearing loss, and ocular disturbances and is passed on genetically, usually in an X-linked manner. Liver fibrosis and cirrhosis are associated with the deposition of collagen IV in the liver. Serum Collagen IV concentrations correlate with hepatic tissue levels of collagen IV in sugjects with alcoholic liver disease and hepatitis C and fall following successful therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57275905679

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 1493 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Denisse Hdez
Charlottesville, US
★★★★★ 5
Is does the job, love it.
Size: 60% Compact
Is really comfy, it does the job, you can't go wrong with it. Just buy it if you have a 75% keyboard or less because is not long. For me is not a problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
T
Verified Purchase
Timothy Porter
Natrona Heights, US
★★★★★ 5
Nice wrist rest
Size: 100% Standard
Comfortable angle, solid enough to not move around but soft enough to be good for long term usage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
E
Verified Purchase
Erik Olson
Port Orchard, US
★★★★★ 5
Excellent wrist rest, BUT not for me
I'm rating this wrist rest 5 stars despite the fact that it's not for me. The reason that it is not for me is simple: My palms get very sweaty, and this makes my palms stick to the wrist rest, making it hard to move my hands around. This is an inherent limitation of the fact that it is made out of wood, and drove me to the 17" x 4" x 0.75" foam wrist rest from Grifiti instead. If you don't have sweaty palms, however, this wrist rest is perfect. It is 4 inches deep instead of the typical 3.1 inches, it is the perfect height and tapered just so for maximum comfort, the wood (Golden Oak color) is beautiful, and the engraved logo is tasteful and non-intrusive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2023
M
Verified Purchase
MM
Lexington, US
★★★★★ 5
The perfect wrist rest. Stop looking, just buy this one!
Color: Onyx, Size: Tenkeyless/TKL Keyboard Wrist Rest, Color: Onyx, Size: Tenkeyless/TKL Keyboard Wrist Rest
The perfect wrist rest. I used those gel and silicone wrist rests thinking the softer they are the better. Not so. This is solid hardwood and my wrists no longer ache after a long day at the computer. The size I picked is perfect for a TKL keyboard. The angles, height, and design are optimal for a comfortable typing experience. Even 8-10 hours of typing! I love Glorious' products, they come so well packaged and attention to every detail is given. Gosh, its just a wrist rest! No, it is a tool that provides comfortable work experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2025
X
Verified Purchase
Xie Xie
Phoenix, US
★★★★★ 5
The wood is great.
I used to use a typical padded wrist pad, but am a heavy sweater. Upon reading another review in regards to that matter I decided to take the plunge on this rest. I have been a user of the Model O mouse from Glorious for a while and liked it so I trusted the company's reputation for taking gamers' needs into consideration. After using it for about a week and playing different types of games/working from home on it, I can say that although your sweat might pool during sweaty moments, it's easy to wipe off and doesn't seem to easily absorb into the wood. The wood itself is of a nice quality, I like the oak over the onyx for a more "real wood" look. There was no difference in comfort for me, you'd think being used to a padded wrist this shift would be "hard" on me, but no, I haven't had any problems. It's ergonomics for typing are also good as I notice my WPM and consistency be higher on multiple tests. All-in-all quite satisfied with the purchase, fits the aesthetic, feel, and ergonomics I was looking for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2021

recommand products