Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD16b, His tagProduct Specification Species Human Synonyms Low affinity immunoglobulin gamma Fc region receptor III B, Fc gamma RIII beta, FcR 10, IgG Fc receptor III 1, FCGR3B, FCG3, FCGR3, IGFR3 Accession O75015 Amino Acid Sequence Protein sequence(O75015, Gly17 Ser200, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCGR3B, FCG3, FCGR3, IGFR3 |
| Accession | O75015 |
| Amino Acid Sequence | Protein sequence(O75015, Gly17-Ser200, with C-10*His) GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:22.5kDa Actual:35-50kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD16, also known as FcγRIII, is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophils, monocytes, macrophages, and certain T cells. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which participate in signal transduction. The most well-researched membrane receptor implicated in triggering lysis by NK cells, CD16 is a molecule of the immunoglobulin superfamily (IgSF) involved in antibody-dependent cellular cytotoxicity (ADCC). It can be used to isolate populations of specific immune cells through fluorescent-activated cell sorting (FACS) or magnetic-activated cell sorting, using antibodies directed towards CD16.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 114 reviews
Sort
Product Reviews
★★★★★ 5
Love denim and tired of cropped jackets?
Fit Type: Oversized, Size: Large, Color: Medium Blue Vintage
I like this a lot, it was what I was looking for as far as I'm so over everything you buy these days is cropped. Cropped styles are great, but are kind of getting old for some things in my opinion. The jacket is big as far as how it fits. I am 5'8" about 180 and I wish I would have got a medium, I got a large.
The large is big and roomy enough that I could even wear ear a thick hoodie under it if I wanted to. However, the length is good as what I was looking for. The upper arms are large. However, this is a great quality denim jacket. Nice and thick, sturdy material (which I wanted).
It's also at a great, competitive low price even if it's not on sale. Don't believe me, go ahead and search jean jackets. You'll see a ton, but I looked too and the quality did not look as good as this and plus the other jackets were a lot more for a lot less. If you're looking for a longer jean jacket, I highly recommend this.
I'd say just think seriously about sizing down 1... even maybe 2 sizes. I would have gotten an XL before I read the other reviews. They recommended to size down, and after getting my jacket I could have sized down to a medium. I'm still happy with it and this is a jacket that is stitched well and will last a very long time.
As always though, that's just my 2 cents. :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
★★★★★ 4
Nice quality, shape not for me
Fit Type: Oversized, Size: Medium, Color: Medium Blue Vintage
This was just too boxy for my body. Material was nice, quality jean material. Color was true to image. It was a little stiff but as you would expect with nice, new and unwashed denim.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 5
Solid basic good denim jacket
Fit Type: Regular, Size: X-Large, Color: Authentic Medium Wash
In direct comparison to Levi’s women’s trucker denim jacket, this one is: slightly heavier denim, less stretchy, less fitted. I kept this one and returned the Levi’s because I wanted the roomier fit. I wish it was a little longer in the body: I’m tall, and it isn’t too short but I’d like a little more length. It feels slightly longer than the Levi’s. I wish the sleeves were longer too. They are probably just right for an average height or shorter person. The armholes could be smaller.
The medium wash is a nice medium blue, fairly even in tone. It doesn’t have a lot of stretch but it’s comfortable. The denim is substantial but not too stiff.
Overall, it’s a standard good quality denim jacket without any peculiar style elements or weird cut. It’s good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
★★★★★ 3
Fabric way to heavy.
Fit Type: Regular, Size: Medium, Color: White
Cute, but material is WAY to heavy, like the heaviest duty denim I've ever seen. Wanted this to be a cute coverup. If you're needing something while breaking broncos or riding your motorcycle would probably be great. I kept it for a while because it was good quality and well made, but it ended up in the donation pile as I'd never wear this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
★★★★★ 5
Awesome jacket
Fit Type: Regular, Size: Medium, Color: Stone Dark Wash
Love it so not too long or too short but just right and the color is out of sight and fits awesome
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 12, 2026
recommand products
Blenko Dimple Pitcher
140.00
Flower Embroidered Patchwork Corduroy Journal
33.99
HP Oversized Bowl
156.00
Handmade Vintage Thread-Bound Notebook • Rustic Kraft Paper Journal • Blank Sketchbook • Minimalist Writing Journal • Hand-Sewn Book Gift
22.99
Casafina Charger Plate/Platter 16" - Impressions
70.00