Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human FSH beta, His tagProduct Specification Species Human Synonyms Follitropin subunit beta, Follicle stimulating hormone beta subunit, Follitropin beta chain Amino Acid Sequence Protein sequence (P01225, Asn19 Glu129, with C 10*His) NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 1kDa Actual: 22kDa Purity 95% by SDS PAGE Endotoxin <1EU
Product Specification
| Species | Human |
| Synonyms | Follitropin subunit beta, Follicle-stimulating hormone beta subunit, Follitropin beta chain |
| Amino Acid Sequence | Protein sequence (P01225, Asn19-Glu129, with C-10*His) NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKEGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 14.1kDa Actual: 22kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Follitropin subunit beta also known as follicle-stimulating hormone beta subunit (FSH-B) is a protein that in humans is encoded by the FSHB gene. The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 1271 reviews
Sort
Product Reviews
★★★★★ 5
Love denim and tired of cropped jackets?
Fit Type: Oversized, Size: Large, Color: Medium Blue Vintage
I like this a lot, it was what I was looking for as far as I'm so over everything you buy these days is cropped. Cropped styles are great, but are kind of getting old for some things in my opinion. The jacket is big as far as how it fits. I am 5'8" about 180 and I wish I would have got a medium, I got a large.
The large is big and roomy enough that I could even wear ear a thick hoodie under it if I wanted to. However, the length is good as what I was looking for. The upper arms are large. However, this is a great quality denim jacket. Nice and thick, sturdy material (which I wanted).
It's also at a great, competitive low price even if it's not on sale. Don't believe me, go ahead and search jean jackets. You'll see a ton, but I looked too and the quality did not look as good as this and plus the other jackets were a lot more for a lot less. If you're looking for a longer jean jacket, I highly recommend this.
I'd say just think seriously about sizing down 1... even maybe 2 sizes. I would have gotten an XL before I read the other reviews. They recommended to size down, and after getting my jacket I could have sized down to a medium. I'm still happy with it and this is a jacket that is stitched well and will last a very long time.
As always though, that's just my 2 cents. :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
★★★★★ 4
Nice quality, shape not for me
Fit Type: Oversized, Size: Medium, Color: Medium Blue Vintage
This was just too boxy for my body. Material was nice, quality jean material. Color was true to image. It was a little stiff but as you would expect with nice, new and unwashed denim.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 5
Solid basic good denim jacket
Fit Type: Regular, Size: X-Large, Color: Authentic Medium Wash
In direct comparison to Levi’s women’s trucker denim jacket, this one is: slightly heavier denim, less stretchy, less fitted. I kept this one and returned the Levi’s because I wanted the roomier fit. I wish it was a little longer in the body: I’m tall, and it isn’t too short but I’d like a little more length. It feels slightly longer than the Levi’s. I wish the sleeves were longer too. They are probably just right for an average height or shorter person. The armholes could be smaller.
The medium wash is a nice medium blue, fairly even in tone. It doesn’t have a lot of stretch but it’s comfortable. The denim is substantial but not too stiff.
Overall, it’s a standard good quality denim jacket without any peculiar style elements or weird cut. It’s good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
★★★★★ 3
Fabric way to heavy.
Fit Type: Regular, Size: Medium, Color: White
Cute, but material is WAY to heavy, like the heaviest duty denim I've ever seen. Wanted this to be a cute coverup. If you're needing something while breaking broncos or riding your motorcycle would probably be great. I kept it for a while because it was good quality and well made, but it ended up in the donation pile as I'd never wear this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
★★★★★ 5
Awesome jacket
Fit Type: Regular, Size: Medium, Color: Stone Dark Wash
Love it so not too long or too short but just right and the color is out of sight and fits awesome
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 12, 2026
recommand products
Casafina Egg Platter - Cook and Host
70.00
Patchwork Fabric Journal A6 A5 | Rabbit Print Travel Diary | Refillable Planner | Portable Notepad | Ring Binder Journal | Cloth Notebook
31.99
PB Deviled Egg Tray
66.00
Self-Adhesive Photo Album: Linen/Kraft Cover, Leather Buckle, Graduation Scrapbook, Guest Book, Family Memory Book, Anniversary Gift
53.99
Costa Nova Lowball Tumblers - Terrazza
30.00