SKU: 78025368036

Mouse NK1.1/CD161, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse NK1.1/CD161, His tagProduct Specification Species Mouse Synonyms Killer cell lectin like receptor subfamily B member 1C, CD161 antigen like family member C, Lymphocyte antigen 55c (Ly 55c), NKR P1. 9, NKR P1C, Natural killer cell surface protein P1 40 (NKR P1 40), Klrb1c Accession P27814 Amino Acid Sequence Protein sequence(P27814, Gln67 Ser223, with C 10*His)

Product Specification


Species Mouse
Synonyms Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c (Ly-55c), NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40 (NKR-P1 40), Klrb1c
Accession P27814
Amino Acid Sequence

Protein sequence(P27814, Gln67-Ser223, with C-10*His) QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:19.6kDa Actual:28kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD161 is one of the earliest markers expressed during NK cell maturation from CD34+ hematopoietic stem cell precursors. Expression of CD161 correlates with the cytotoxic function of CD16+ NK cells, and ligation of CD161 with its ligand LLT1 inhibits NK cell cytotoxicity and cytokine secretion. CD161 is expressed early in NK cell development, where it may facilitate cross-talk of NK cell precursors with cells within the bone marrow, and is involved in CXCL8 release. Within the periphery, cross-linking of CD161 leads to an increase in IFNγ expression and inhibition of NK cell cytotoxicity. There have been various reports of modulated expression of CD161 on NK cells during viral infections. For instance, reduced CD161 expression in acute hepatitis C virus (HCV) infection predicted viral clearance, and correlated with increased liver inflammation in chronic HCV infection. Patients with chronic human immunodeficiency virus (HIV) infection have depleted CD161+ NK cells compared to healthy donors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78025368036

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1050 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Vieux
Whiting, US
★★★★★ 5
Excellent monitor, return of first defective one was a breeze.
The first monitor that I received displayed tearing, flickering, and artifacts at 144hz refresh, using an RTX5080 Nvidia graphics card when playing Il2-Sturmovik at highest graphic settings. I thought I would give Crua another chance and requested a replacement. Amazon sent me a new monitor immediately which arrived 2 days later. I simply swapped out the screen and returned the defective monitor in the box the replacement was sent in. It was painless. I have had the new monitor for a couple of weeks and it has been flawless. Great color, sharp image, no dead pixels, stable at 160hz refresh. I cant vouch for its longevity yet, but I will give an update after 6 months or so. Otherwise, this is the best monitor for the money that I have found in its class, and has made an impressive improvement to my setup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
K
Verified Purchase
Kim
Alexandria, US
★★★★★ 5
Surprising quality, great for work
Size: 34 Inch, Size: 34 Inch
I know this is advertised as a gaming monitor, but I decided to get a large, wide monitor for long work hours to replace my two 27 inch monitors. It has just enough width that you can easily split the screen and work side-by-side. It is genuinely helped my neck pain since my posture is staying straight. There is no lag in the monitor and it has a pretty good design. Nice and thin, sleek. The amount on the back of it was a little strange, but I figured it out. The only thing I don’t like about this monitor is you cannot adjust the height up and down and it does not tilt but for the price I can live with that. It does give you the option to mount on a wall, which is nice. This might be a me problem, but it didn’t want to register with my thunderbolt docking station. I ended up needing to plug it directly into the laptop, which is an ideal. Haven’t figured out if that’s the monitor operation or if I need to connect it in a different way. Overall, this is a great value for the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
M
Verified Purchase
Mystic
Belleville, US
★★★★★ 3
Very poor delivery and unboxing experience
Size: 34, Size: 34
2/12/26 Shipping was beyond poor. Amazon packaged this in a oversized box with no padding. Monitor box inside was damaged, but product seems ok. I was initially going to return and left a scathing feedback review for amazon delivery being beyond poor, when I requested a call there service kept hanging up on me. Shame on you Amazon, unfortunately I am removing one star for that. Now onto the real review... Monitor is sharp with no dead pixels, however the protective film is weird. So weird I thought I had received a used product, when I went to peel the film the sticker ripped and I had to carefully inspect to discover there was actually film and not someone pulling one over on amazon on a return. One star removed for that horrible film experience, it was very jarring. There is no height adjustment only tilt, which is fine nothing unexpected there. Stand is actually quality and is a Metal Injection Molding (MIM) material which is impressive for the price, not weighted plastic like some of the higher end brands. I like that there is no horrible blue light signaling the monitor is on, but that can be a turn off for some as the black levels of monitor can confuse someone into thinking it is not working. However if you are a photographer or a gamer this is a huge plus. Kudus to CRUA for doing that. I will update review upon testing to see if product needs less stars or if amazon wants to chime in on their part in this experience to add stars back. CRUA get on amazon so you can be a solid 4 stars! At this point I would recommend, but beware the film.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
I
Verified Purchase
iNDi
Belleville, US
★★★★★ 4
CRUA delivers in price and panel quality, but stumbles in build quality
If they could just solve their quality control issues then this might be one of the best monitors I have purchased for the price it is offered at. Major monitor brands should be absolutely ashamed that this comes within striking quality of monitors are 3-6x its price. My only advice to anyone else looking to buy this is to get an extended warranty for it because CRUA does have serious quality control issues and weak components. But the actual panel, colors, etc are way above the asking price. I am absolutely floored.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
K
Verified Purchase
KenjiFox
Chelsea, US
★★★★★ 5
This monitor is spectacular for the price. I am very pleased with it.
Size: 27 Inch
It arrived in tact and has zero blemishes or dead pixels. That's saying something when you have this many pixels too. The Freesync works great, it's fairly bright and the colors are amazing. They need to be detuned quite a lot since the gamut is way higher than most content is created for. Gaming is fantastic. I do not seem to have the advertised 1080P high FPS mode though. Perhaps they crossed up some of the promotional information for a different model. Still, I am very much enjoying 160Hz at 4k. I am playing through games again just to see them so clearly, and that's going from a 2k monitor of the same size. This display is superior. I wish the power button that's modeled to look like a joystick actually was one, don't be caught off guard by that. It's just a button. I knew that when I bought it but still. Kinda... iffy to make it look like one. I mounted the monitor on an arm. It weighs very little so it was easy. I never used the included stand, but it's very sturdy and I love that is flips vertically too. The headphone jack works nicely for my powered speakers and it switches between display port and HDMI correctly. My last monitor had to be restarted each time I went back to Display Port to get audio back. This monitor at the price I paid is insanely good. I'd been waiting for years for a good 4K panel with high refresh rate at 27". By far my favorite monitor size. I have zero intention of changing or upgrading from this panel until μLED is finally available. If this panel dies, I will get another until then.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026

recommand products