SKU: 46503601985

Human pro-GRP, His Tag

$166.50 $185.00
Save 10%
No.2 Bestseller on chemicals-recycling.com >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human pro-GRP, His TagProduct Specification Species Human Accession P07492 Amino Acid Sequence Protein sequence(P07492, Ser54 Asp121 with C 10*His) STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 9. 4kDa Actual: 13kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute no more than 0. 1 mg mL

Product Specification


Species Human
Accession P07492
Amino Acid Sequence

Protein sequence(P07492, Ser54-Asp121 with C-10*His)


STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical: 9.4kDa Actual: 13kDa
Purity

＞95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pro-Gastrin-Releasing-Peptide, also known as Pro-GRP, is a Gastrin-Releasing-Peptide (GRP) precursor, a neurotransmitter that belongs to the bombesine/neuromedin B family. GRP stimulates the secretion of gastrin in order to increase the acidity of the gastric acid. Pro-GRP is a peptide composed of 125 amino acids, expressed in the nervous system and digestive tract. In pathological situations, GRP has mitogenic activity in vitro in many tumors such as pancreatic, small cell lung (SCLC), prostate, kidney, breast and colorectal cancers. GRP could operate as an autocrine growth factor. In cancers, GRP induces cell growth and inhibits apoptosis by shutting down the endoplasmic reticulum stress pathway. As early as 1994, research on Pro-GRP as a biomarker for small cell lung cancer began. Because of the very short half-life of GRP (2 minutes), the Pro-GRP is used for measurements and analysis. Since then, Pro-GRP has been used as a tumor marker for patients with small cell lung cancer (SCLC) in limited and extended stages.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46503601985

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 712 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
sue d
Charlottesville, US
★★★★★ 5
How easy they are. And space saving
Item Package Quantity: 2
These are great. Made such a difference in my cupboards. Would rate as a 10
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
J
Julie B
Massapequa, US
★★★★★ 5
Finally solved my spice cabinet chaos
Item Package Quantity: 2
I didn’t realize how much time I was wasting digging through my spice cabinet until I installed these. My spices used to be stacked behind one another, which meant every time I needed a specific seasoning, I had to move half the cabinet around just to find it. These racks completely solved that problem. What immediately appealed to me was the no-drill installation. I rent my home, so I’m always hesitant to make permanent changes to cabinets. The peel-and-stick setup was surprisingly easy, and I had both racks installed in just a few minutes. Once attached, they felt much more secure than I expected. I was initially skeptical about adhesive mounting, but they’ve stayed firmly in place. The pull-out design is where these really shine. Instead of reaching into a dark cabinet and searching through rows of jars, I can simply slide the rack out and instantly see everything. It’s one of those organizational upgrades that makes everyday cooking noticeably easier. I also appreciate the adjustable height feature. My spice collection includes a mix of different bottle sizes, and I was able to configure the racks to accommodate both smaller and larger containers without any issues. The flexibility makes them much more useful than fixed-size organizers. Another thing I noticed is how much cabinet space they helped free up. By using vertical space more efficiently, my cabinet feels less cluttered and much more organized. I can now find exactly what I need without knocking over other jars or creating a mess. The overall construction feels sturdy, and the sliding action remains smooth even when the racks are fully loaded. This is one of those products that seems basic but ends up making a bigger difference than expected. If your spice cabinet is crowded, disorganized, or constantly frustrating to use, these racks are an easy solution. They’ve made cooking more convenient, improved organization, and helped maximize storage space. For me, that’s an easy five-star product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
S
S. O.
Lowell, US
★★★★★ 5
Finally, a Spice Rack That Fixes the Real Problem—Access Without the Hassle
Item Package Quantity: 2
I am pleasantly surprised at how handy this spice rack is!! This iSPECLE pull-out spice rack does that others rarely deliver... makes your daily routine just that much easier. The biggest win here is access. No longer having to rummage through a messy cabinet or knock over jars to retrieve whatever you’re looking for. With everything just sliding out and coming up right in front of you. The idea is simple, but it creates a difference. There's your strong point here: the no-drill, peel-and-stick installation. It’s simple and time-saving, which is something. That being said, it still needs to be installed correctly. Use a clean surface, pressure, and time to set. Do that, and it holds well. Overlook that step, and you’ll be blaming the product when it’s all set up for you. The adjustable height is practical, especially if you’re working with a mix of 4oz and 8oz spice jars. It’s not flashy, but it offers a solution to the same annoying problem: trying to cram mismatched containers into a rigid system. What impresses me the most is that it provides some order rather than making things ever murkier. It’s not looking to reinvent your kitchen. It takes a common frustration (buried spices in dark cabinets) and makes it neat and clean for practicality's sake. Bottom line: If your cabinet seems like a black hole of spices, this is an easy, straightforward solution. Not anything fancy, just smart design and it works!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
M
Michael midkiff
Fort Morgan, US
★★★★★ 5
Be Mindful Of The Height
Item Package Quantity: 2
So this spice rack is amazing, if you know what you're getting. I have had a similar one in the past that was just one level. It was great and made organization easy. This being two levels tall means you have to take that into account because it's going to change the shelve layout in your spice cabinet. It wasn't a problem for me and still ended up being a net positive for making the most out of the space, but my friend bought the same ones and ended up sending them back because they wouldn't fit into his smaller cabinet. If you are aware of that going in and know it's going to work for you, they are amazing. They slide smoothly, they hold a ton, and make getting to the items in the back infinitely better. Decent price for such a huge quality of life improvement for my kitchen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
D
Don T.
Pawtucket, US
★★★★★ 4
Didn't entirely save me from the mess, but it got close!
Item Package Quantity: 2, Item Package Quantity: 2
I set these up in my little mini pantry that is admittedly a bit of a mess before AND after, but now it's an organized mess that I can navigate with a bit more ease. It fits well in the space that I have, and the rollers are high quality and feel smooth. If organized chaos speaks to you and you've acknowledged that, this is a great fit!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026

recommand products

Ragan & Massey Compare-N-Save Concentrate Grass and Weed Killer 41% Glyphosate
15.99
BMW 3 Series F30 F35 LB FRP Wide Body Kit
1200.00
Miata Durable Side Skirts
150.00
Junction Produce Fusa Kiku Knot
75.00
2013-2016 for LB Body Kit for BMW 4 Series
2050.00